RPS14 Antikörper (N-Term)

Produktnummer ABIN629966

Der Kaninchen Polyklonal Anti-RPS14-Antikörper wurde für WB validiert. Er ist geeignet, RPS14 in Proben von Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio) zu detektieren.

Kurzübersicht für RPS14 Antikörper (N-Term) (ABIN629966)

Target: RPS14 (Ribosomal Protein S14 (RPS14))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPS14 Antikörper

Bindungsspezifität: N-Term

Spezifität: RPS14 antibody was raised against the N terminal of RPS14

Aufreinigung: Purified

Immunogen: RPS14 antibody was raised using the N terminal of RPS14 corresponding to a region with amino acids APRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS14 Blocking Peptide, catalog no. 33R-1437, is also available for use as a blocking control in assays to test for specificity of this RPS14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS14

Target: RPS14 (Ribosomal Protein S14 (RPS14))

Andere Bezeichnung: RPS14

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS14 is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly