MATR3 Antikörper (C-Term)
-
- Target Alle MATR3 Antikörper anzeigen
- MATR3 (Matrin 3 (MATR3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MATR3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Matrin 3 antibody was raised against the C terminal of MATR3
- Aufreinigung
- Purified
- Immunogen
- Matrin 3 antibody was raised using the C terminal of MATR3 corresponding to a region with amino acids ADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTG
- Top Product
- Discover our top product MATR3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Matrin 3 Blocking Peptide, catalog no. 33R-1084, is also available for use as a blocking control in assays to test for specificity of this Matrin 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATR3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MATR3 (Matrin 3 (MATR3))
- Andere Bezeichnung
- Matrin 3 (MATR3 Produkte)
- Synonyme
- MPD2 antikoerper, VCPDM antikoerper, 1110061A14Rik antikoerper, 2810017I02Rik antikoerper, AI841759 antikoerper, AW555618 antikoerper, D030046F20Rik antikoerper, mKIAA0723 antikoerper, P130/MAT3 antikoerper, matrin-3 antikoerper, matr3 antikoerper, MGC79524 antikoerper, MATR3 antikoerper, DKFZp459A057 antikoerper, DKFZp459A162 antikoerper, DKFZp459F0515 antikoerper, DKFZp469A1933 antikoerper, LOC100232255 antikoerper, KIAA0723 antikoerper, matrin 3 antikoerper, matrin 3 S homeolog antikoerper, MATR3 antikoerper, Matr3 antikoerper, matr3.S antikoerper, matr3 antikoerper
- Hintergrund
- MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.
- Molekulargewicht
- 94 kDa (MW of target protein)
-