MATR3 Antikörper (C-Term)

Produktnummer ABIN629963

Der Kaninchen Polyklonal anti-MATR3 Antikörper wird verwendet zum Nachweis von MATR3 in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für MATR3 Antikörper (C-Term) (ABIN629963)

Target: MATR3 (Matrin 3 (MATR3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MATR3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MATR3 Antikörper

Bindungsspezifität: C-Term

Spezifität: Matrin 3 antibody was raised against the C terminal of MATR3

Aufreinigung: Purified

Immunogen: Matrin 3 antibody was raised using the C terminal of MATR3 corresponding to a region with amino acids ADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Matrin 3 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Matrin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATR3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MATR3

Target: MATR3 (Matrin 3 (MATR3))

Andere Bezeichnung: Matrin 3

Hintergrund: MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.

Molekulargewicht: 94 kDa (MW of target protein)