MATR3 Antikörper (N-Term)

Produktnummer ABIN629962

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MATR3 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für MATR3 Antikörper (N-Term) (ABIN629962)

Target: MATR3 (Matrin 3 (MATR3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MATR3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-MATR3 Antikörper

Bindungsspezifität: N-Term

Spezifität: Matrin 3 antibody was raised against the N terminal of MATR3

Aufreinigung: Purified

Immunogen: Matrin 3 antibody was raised using the N terminal of MATR3 corresponding to a region with amino acids MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Matrin 3 Blocking Peptide, (ABIN5614682), is also available for use as a blocking control in assays to test for specificity of this Matrin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATR3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MATR3

Target: MATR3 (Matrin 3 (MATR3))

Andere Bezeichnung: Matrin 3

Hintergrund: MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.

Molekulargewicht: 93 kDa (MW of target protein)