DDX19B Antikörper

Produktnummer ABIN629961

Dieses Anti-DDX19B-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DDX19B in WB. Geeignet für Human, Maus, Ratte, Zebrafisch (Danio rerio) und Hund.

Kurzübersicht für DDX19B Antikörper (ABIN629961)

Target: DDX19B (DEAD (Asp-Glu-Ala-As) Box Polypeptide 19B (DDX19B))

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX19B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDX19B Antikörper

Aufreinigung: Purified

Immunogen: DDX19 B antibody was raised using a synthetic peptide corresponding to a region with amino acids GKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX19B Blocking Peptide, (ABIN938744), is also available for use as a blocking control in assays to test for specificity of this DDX19B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX19B

Target: DDX19B (DEAD (Asp-Glu-Ala-As) Box Polypeptide 19B (DDX19B))

Andere Bezeichnung: DDX19B

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX19B is a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities.

Molekulargewicht: 53 kDa (MW of target protein)