DDX46 Antikörper

Produktnummer ABIN629960

Der Kaninchen Polyklonal Anti-DDX46-Antikörper wurde für WB validiert. Er ist geeignet, DDX46 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für DDX46 Antikörper (ABIN629960)

Target: DDX46 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 46 (DDX46))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX46 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDX46 Antikörper

Aufreinigung: Purified

Immunogen: DDX46 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX46 Blocking Peptide, (ABIN938633), is also available for use as a blocking control in assays to test for specificity of this DDX46 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX46 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX46

Target: DDX46 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 46 (DDX46))

Andere Bezeichnung: DDX46

Hintergrund: DDX46 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX46 is a component of the 17S U2 snRNP complex, it plays an important role in pre-mRNA splicing.

Molekulargewicht: 113 kDa (MW of target protein)