DDX23 Antikörper

Produktnummer ABIN629956

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DDX23 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für DDX23 Antikörper (ABIN629956)

Target: DDX23 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 23 (DDX23))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX23 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDX23 Antikörper

Aufreinigung: Purified

Immunogen: DDX23 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX23 Blocking Peptide, (ABIN937714), is also available for use as a blocking control in assays to test for specificity of this DDX23 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX23 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX23

Target: DDX23 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 23 (DDX23))

Andere Bezeichnung: DDX23

Hintergrund: DDX23 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Molekulargewicht: 90 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization