DDX5 Antikörper

Produktnummer ABIN629955

Produktdetails anti-DDX5 Antikörper

Target: DDX5 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: DDX5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX5 Blocking Peptide, catalog no. 33R-8427, is also available for use as a blocking control in assays to test for specificity of this DDX5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX5

Target: DDX5 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5))

Andere Bezeichnung: DDX5 (DDX5 Produkte)

Synonyme: G17P1 antikoerper, HLR1 antikoerper, HUMP68 antikoerper, p68 antikoerper, 2600009A06Rik antikoerper, Hlr1 antikoerper, wu:fa56a07 antikoerper, wu:fb11e01 antikoerper, wu:fb16c10 antikoerper, wu:fb53b05 antikoerper, ddx5 antikoerper, DEAD-box helicase 5 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 antikoerper, DEAD (Asp-Glu-Ala-Asp) box helicase 5 antikoerper, DEAD-box helicase 5 L homeolog antikoerper, DDX5 antikoerper, Ddx5 antikoerper, ddx5 antikoerper, ddx5.L antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX5 encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. DDX5 consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded by these transcripts have been identified.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding, Regulation of Muscle Cell Differentiation, Positive Regulation of Response to DNA Damage Stimulus