DDX55 Antikörper

Produktnummer ABIN629953

Produktdetails anti-DDX55 Antikörper

Target: DDX55 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 55 (DDX55))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX55 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: DDX55 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX55 Blocking Peptide, catalog no. 33R-3374, is also available for use as a blocking control in assays to test for specificity of this DDX55 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX55 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX55

Target: DDX55 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 55 (DDX55))

Andere Bezeichnung: DDX55 (DDX55 Produkte)

Synonyme: 2810021H22Rik antikoerper, mKIAA1595 antikoerper, chunp6861 antikoerper, fc32a12 antikoerper, kiaa1595 antikoerper, wu:fc32a12 antikoerper, ddx55 antikoerper, MGC78784 antikoerper, DDX55 antikoerper, DEAD-box helicase 55 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 antikoerper, DEAD-box helicase 55 S homeolog antikoerper, DDX55 antikoerper, Ddx55 antikoerper, ddx55 antikoerper, ddx55.S antikoerper

Hintergrund: Anti-DDX55 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Multiple alternatively spliced transcript variants have been found for Anti-DDX55, but the biological validity of only one transcript has been confirmed.

Molekulargewicht: 66 kDa (MW of target protein)