PCBP2 Antikörper

Produktnummer ABIN629951

Der Kaninchen Polyklonal Anti-PCBP2-Antikörper wurde für WB und IHC validiert. Er ist geeignet, PCBP2 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für PCBP2 Antikörper (ABIN629951)

Target: PCBP2 (Poly(rC) Binding Protein 2 (PCBP2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PCBP2 Antikörper

Aufreinigung: Purified

Immunogen: PCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCBP2 Blocking Peptide, (ABIN5615234), is also available for use as a blocking control in assays to test for specificity of this PCBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCBP2

Target: PCBP2 (Poly(rC) Binding Protein 2 (PCBP2))

Andere Bezeichnung: PCBP2

Hintergrund: PCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.

Molekulargewicht: 40 kDa (MW of target protein)