GRSF1 Antikörper (N-Term)

Produktnummer ABIN629949

Dieses Anti-GRSF1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von GRSF1 in WB. Geeignet für Human.

Kurzübersicht für GRSF1 Antikörper (N-Term) (ABIN629949)

Target: GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRSF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GRSF1 Antikörper

Bindungsspezifität: N-Term

Spezifität: GRSF1 antibody was raised against the N terminal of GRSF1

Aufreinigung: Purified

Immunogen: GRSF1 antibody was raised using the N terminal of GRSF1 corresponding to a region with amino acids SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GRSF1 Blocking Peptide, (ABIN5613876), is also available for use as a blocking control in assays to test for specificity of this GRSF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRSF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GRSF1

Target: GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))

Andere Bezeichnung: GRSF1

Hintergrund: GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.

Molekulargewicht: 47 kDa (MW of target protein)