PAIP1 Antikörper

Produktnummer ABIN629948

Der Kaninchen Polyklonal Anti-PAIP1-Antikörper wurde für WB und IHC validiert. Er ist geeignet, PAIP1 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für PAIP1 Antikörper (ABIN629948)

Target: PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAIP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PAIP1 Antikörper

Aufreinigung: Purified

Immunogen: PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAIP1 Blocking Peptide, catalog no. 33R-2650, is also available for use as a blocking control in assays to test for specificity of this PAIP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAIP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAIP1

Target: PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))

Andere Bezeichnung: PAIP1

Hintergrund: PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.

Molekulargewicht: 44 kDa (MW of target protein)