TARBP2 Antikörper

Produktnummer ABIN629947

Produktdetails anti-TARBP2 Antikörper

Target: TARBP2 (TAR (HIV-1) RNA Binding Protein 2 (TARBP2))

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TARBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: TARBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TARBP2 Blocking Peptide, catalog no. 33R-1405, is also available for use as a blocking control in assays to test for specificity of this TARBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TARBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TARBP2

Target: TARBP2 (TAR (HIV-1) RNA Binding Protein 2 (TARBP2))

Andere Bezeichnung: TARBP2 (TARBP2 Produkte)

Synonyme: trbp antikoerper, trbp1 antikoerper, trbp2 antikoerper, MGC97783 antikoerper, TARBP2 antikoerper, LOQS antikoerper, TRBP antikoerper, TRBP1 antikoerper, TRBP2 antikoerper, fj51e12 antikoerper, wu:fj51e12 antikoerper, zgc:63778 antikoerper, Prbp antikoerper, TAR (HIV-1) RNA binding protein 2 antikoerper, TARBP2, RISC loading complex RNA binding subunit antikoerper, TAR (HIV-1) RNA binding protein 2 L homeolog antikoerper, TAR (HIV) RNA binding protein 2 antikoerper, tarbp2 antikoerper, TARBP2 antikoerper, tarbp2.L antikoerper, Tarbp2 antikoerper

Hintergrund: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARBP2 binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein.

Molekulargewicht: 8 kDa (MW of target protein)

Pathways: Regulatorische RNA Pathways, Ribonucleoprotein Complex Subunit Organization