DDX50 Antikörper

Produktnummer ABIN629940

Dieser Anti-DDX50 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von DDX50 in WB. Geeignet für Human und Hund.

Kurzübersicht für DDX50 Antikörper (ABIN629940)

Target: DDX50 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 50 (DDX50))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX50 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDX50 Antikörper

Aufreinigung: Purified

Immunogen: DDX50 antibody was raised using a synthetic peptide corresponding to a region with amino acids EESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX50 Blocking Peptide, (ABIN937774), is also available for use as a blocking control in assays to test for specificity of this DDX50 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX50

Target: DDX50 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 50 (DDX50))

Andere Bezeichnung: DDX50

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Molekulargewicht: 81 kDa (MW of target protein)