HNRNPA0 Antikörper (Middle Region)

Produktnummer ABIN629936

Der Kaninchen Polyklonal anti-HNRNPA0 Antikörper wird verwendet zum Nachweis von HNRNPA0 in Proben von Human. Er wurde validiert für WB und IHC.

Kurzübersicht für HNRNPA0 Antikörper (Middle Region) (ABIN629936)

Target: HNRNPA0 (Heterogeneous Nuclear Ribonucleoprotein A0 (HNRNPA0))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPA0 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-HNRNPA0 Antikörper

Bindungsspezifität: Middle Region

Spezifität: HNRPA0 antibody was raised against the middle region of HNRPA0

Aufreinigung: Purified

Immunogen: HNRPA0 antibody was raised using the middle region of HNRPA0 corresponding to a region with amino acids KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG

Anwendungsinformationen

Applikationshinweise: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRPA0 Blocking Peptide, (ABIN939620), is also available for use as a blocking control in assays to test for specificity of this HNRPA0 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPA0

Target: HNRNPA0 (Heterogeneous Nuclear Ribonucleoprotein A0 (HNRNPA0))

Andere Bezeichnung: HNRPA0

Hintergrund: HNRPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.

Molekulargewicht: 34 kDa (MW of target protein)