CPEB2 Antikörper (Middle Region)

Produktnummer ABIN629930

Der Kaninchen Polyklonal Anti-CPEB2-Antikörper wurde für WB validiert. Er ist geeignet, CPEB2 in Proben von Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio) und Drosophila melanogaster zu detektieren.

Kurzübersicht für CPEB2 Antikörper (Middle Region) (ABIN629930)

Target: CPEB2 (Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPEB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CPEB2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CPEB2 antibody was raised against the middle region of CPEB2

Aufreinigung: Purified

Immunogen: CPEB2 antibody was raised using the middle region of CPEB2 corresponding to a region with amino acids DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CPEB2 Blocking Peptide, (ABIN937577), is also available for use as a blocking control in assays to test for specificity of this CPEB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPEB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPEB2

Target: CPEB2 (Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2))

Andere Bezeichnung: CPEB2

Hintergrund: CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.

Molekulargewicht: 37 kDa (MW of target protein)