DRB1 Antikörper (N-Term)

Produktnummer ABIN629925

Produktdetails anti-DRB1 Antikörper

Target: DRB1 (Dopamine Receptor Binding 1 (DRB1))

Bindungsspezifität: N-Term

Reaktivität: Maus, Ratte, Hund, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DRB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DRB1 antibody was raised against the N terminal of DRB1

Aufreinigung: Purified

Immunogen: DRB1 antibody was raised using the N terminal of DRB1 corresponding to a region with amino acids MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DRB1 Blocking Peptide, catalog no. 33R-5829, is also available for use as a blocking control in assays to test for specificity of this DRB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DRB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DRB1

Target: DRB1 (Dopamine Receptor Binding 1 (DRB1))

Andere Bezeichnung: DRB1 (DRB1 Produkte)

Synonyme: dopamine receptor binding 1 antikoerper, Drb1 antikoerper

Hintergrund: DRB1 is RNA-binding protein with binding specificity for poly(C) and may play an important role in neural development.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg, Positive Regulation of Peptide Hormone Secretion, Production of Molecular Mediator of Immune Response, CXCR4-mediated Signaling Events