Nucleolar Protein 6 Antikörper

Produktnummer ABIN629920

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Nucleolar Protein 6 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Nucleolar Protein 6 Antikörper (ABIN629920)

Target: Nucleolar Protein 6 (NOL6)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Nucleolar Protein 6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-Nucleolar Protein 6 Antikörper

Aufreinigung: Purified

Immunogen: NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 16 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NOL6 Blocking Peptide, (ABIN5615022), is also available for use as a blocking control in assays to test for specificity of this NOL6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOL6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Nucleolar Protein 6

Target: Nucleolar Protein 6 (NOL6)

Andere Bezeichnung: NOL6

Hintergrund: NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts.

Molekulargewicht: 22 kDa (MW of target protein)