Trnt1 Antikörper (N-Term)

Produktnummer ABIN629918

Der Kaninchen Polyklonal Anti-Trnt1-Antikörper wurde für WB und IHC validiert. Er ist geeignet, Trnt1 in Proben von Human zu detektieren.

Kurzübersicht für Trnt1 Antikörper (N-Term) (ABIN629918)

Target: Trnt1 (tRNA Nucleotidyl Transferase, CCA-Adding, 1 (Trnt1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Trnt1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-Trnt1 Antikörper

Bindungsspezifität: N-Term

Spezifität: TRNT1 antibody was raised against the N terminal of TRNT1

Aufreinigung: Purified

Immunogen: TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 16 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRNT1 Blocking Peptide, catalog no. 33R-7294, is also available for use as a blocking control in assays to test for specificity of this TRNT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRNT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Trnt1

Target: Trnt1 (tRNA Nucleotidyl Transferase, CCA-Adding, 1 (Trnt1))

Andere Bezeichnung: TRNT1

Hintergrund: TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates.

Molekulargewicht: 45 kDa (MW of target protein)