EXOSC2 Antikörper (N-Term)
-
- Target Alle EXOSC2 Antikörper anzeigen
- EXOSC2 (Exosome Component 2 (EXOSC2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EXOSC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EXOSC2 antibody was raised against the N terminal of EXOSC2
- Aufreinigung
- Purified
- Immunogen
- EXOSC2 antibody was raised using the N terminal of EXOSC2 corresponding to a region with amino acids RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV
- Top Product
- Discover our top product EXOSC2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EXOSC2 Blocking Peptide, catalog no. 33R-8007, is also available for use as a blocking control in assays to test for specificity of this EXOSC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EXOSC2 (Exosome Component 2 (EXOSC2))
- Andere Bezeichnung
- EXOSC2 (EXOSC2 Produkte)
- Synonyme
- EXOSC2 antikoerper, exosc2 antikoerper, MGC97533 antikoerper, RRP4 antikoerper, Rrp4p antikoerper, hRrp4p antikoerper, p7 antikoerper, Rrp4 antikoerper, fa97b01 antikoerper, wu:fa97b01 antikoerper, zgc:110117 antikoerper, exosome component 2 antikoerper, exosome component 2 L homeolog antikoerper, EXOSC2 antikoerper, exosc2 antikoerper, Bm1_33895 antikoerper, PTRG_00114 antikoerper, Exosc2 antikoerper, exosc2.L antikoerper
- Hintergrund
- EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.
- Molekulargewicht
- 32 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-