ADAT1 Antikörper (C-Term)

Produktnummer ABIN629916

Dieses Anti-ADAT1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ADAT1 in WB und IHC. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für ADAT1 Antikörper (C-Term) (ABIN629916)

Target: ADAT1 (Adenosine Deaminase, tRNA-Specific 1 (ADAT1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-ADAT1 Antikörper

Bindungsspezifität: C-Term

Spezifität: ADAT1 antibody was raised against the C terminal of ADAT1

Aufreinigung: Purified

Immunogen: ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids RLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELF

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADAT1 Blocking Peptide, (ABIN5611943), is also available for use as a blocking control in assays to test for specificity of this ADAT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADAT1

Target: ADAT1 (Adenosine Deaminase, tRNA-Specific 1 (ADAT1))

Andere Bezeichnung: ADAT1

Hintergrund: ADAT1 is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, the family participates in the pre-mRNA editing of nuclear transcripts. ADAT1, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.

Molekulargewicht: 39 kDa (MW of target protein)