RPP29 Antikörper

Produktnummer ABIN629915

Der Kaninchen-Polyklonal Anti-RPP29-Antikörper wurde für WB und IHC validiert. Er ist geeignet zum Nachweis von RPP29 in Proben aus Human und Hund. }

Kurzübersicht für RPP29 Antikörper (ABIN629915)

Target: RPP29 (POP4) (Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPP29 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RPP29 Antikörper

Aufreinigung: Purified

Immunogen: POP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POP4 Blocking Peptide, (ABIN937713), is also available for use as a blocking control in assays to test for specificity of this POP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPP29

Target: RPP29 (POP4) (Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4))

Andere Bezeichnung: POP4

Hintergrund: POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. It may function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P.

Molekulargewicht: 24 kDa (MW of target protein)