EXOSC7 Antikörper (N-Term)

Produktnummer ABIN629910

Dieses Anti-EXOSC7-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von EXOSC7 in WB und IHC. Geeignet für Human, Ratte, Maus und Hund.

Kurzübersicht für EXOSC7 Antikörper (N-Term) (ABIN629910)

Target: EXOSC7 (Exosome Component 7 (EXOSC7))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EXOSC7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-EXOSC7 Antikörper

Bindungsspezifität: N-Term

Spezifität: EXOSC7 antibody was raised against the N terminal of EXOSC7

Aufreinigung: Purified

Immunogen: EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXOSC7 Blocking Peptide, catalog no. 33R-4910, is also available for use as a blocking control in assays to test for specificity of this EXOSC7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EXOSC7

Target: EXOSC7 (Exosome Component 7 (EXOSC7))

Andere Bezeichnung: EXOSC7

Hintergrund: EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.

Molekulargewicht: 32 kDa (MW of target protein)