EXOSC4 Antikörper (N-Term)

Produktnummer ABIN629903

Der Kaninchen Polyklonal Anti-EXOSC4-Antikörper wurde für WB und IHC validiert. Er ist geeignet, EXOSC4 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für EXOSC4 Antikörper (N-Term) (ABIN629903)

Target: EXOSC4 (Exosome Component 4 (EXOSC4))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EXOSC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-EXOSC4 Antikörper

Bindungsspezifität: N-Term

Spezifität: EXOSC4 antibody was raised against the N terminal of EXOSC4

Aufreinigung: Purified

Immunogen: EXOSC4 antibody was raised using the N terminal of EXOSC4 corresponding to a region with amino acids SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXOSC4 Blocking Peptide, (ABIN5613435), is also available for use as a blocking control in assays to test for specificity of this EXOSC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EXOSC4

Target: EXOSC4 (Exosome Component 4 (EXOSC4))

Andere Bezeichnung: EXOSC4

Hintergrund: EXOSC4 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. It has a 3'-5' exonuclease activity.

Molekulargewicht: 27 kDa (MW of target protein)