HNRNPL Antikörper (N-Term)

Produktnummer ABIN629902

Produktdetails anti-HNRNPL Antikörper

Target: HNRNPL (Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: HNRPL antibody was raised against the N terminal of HNRPL

Aufreinigung: Purified

Immunogen: HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHD

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRPL Blocking Peptide, catalog no. 33R-2211, is also available for use as a blocking control in assays to test for specificity of this HNRPL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPL

Target: HNRNPL (Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL))

Andere Bezeichnung: HNRPL (HNRNPL Produkte)

Synonyme: HNRPL antikoerper, hnRNP-L antikoerper, zgc:55429 antikoerper, HNRNPL antikoerper, hnrpl antikoerper, C79783 antikoerper, D830027H13Rik antikoerper, Hnrpl antikoerper, hnrnp-L antikoerper, heterogeneous nuclear ribonucleoprotein L antikoerper, HNRNPL antikoerper, hnrpl antikoerper, hnrnpl antikoerper, Hnrnpl antikoerper

Hintergrund: Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA.

Molekulargewicht: 65 kDa (MW of target protein)