THO Complex 4 Antikörper (N-Term)
-
- Target Alle THO Complex 4 (THOC4) Antikörper anzeigen
- THO Complex 4 (THOC4)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser THO Complex 4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- THOC4 antibody was raised against the N terminal of THOC4
- Aufreinigung
- Purified
- Immunogen
- THOC4 antibody was raised using the N terminal of THOC4 corresponding to a region with amino acids GGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGA
- Top Product
- Discover our top product THOC4 Primärantikörper
-
anti-THO Complex 4 (THOC4) antibody
THOC4 Reaktivität: Human, Maus, Ratte WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-THO Complex 4 (THOC4) antibodyTHOC4 Reaktivität: Human WB, IF, IP, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-THO Complex 4 (THOC4) antibodyTHOC4 Reaktivität: Human WB, IHC Wirt: Kaninchen Monoclonal unconjugated
anti-THO Complex 4 (THOC4) (AA 106-193) antibodyTHOC4 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 2G8 unconjugated
anti-THO Complex 4 (THOC4) (AA 186-240) antibodyTHOC4 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-THO Complex 4 (THOC4) antibodyTHOC4 Reaktivität: Human, Xenopus laevis WB, ELISA, IF, IP, IHC (p), ICC, ChIP, EM, FACS Wirt: Maus Monoclonal 11G5 unconjugated
anti-THO Complex 4 (THOC4) (Internal Region) antibodyTHOC4 Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-THO Complex 4 (THOC4) (AA 58-107) antibodyTHOC4 Reaktivität: Human, Maus, Ratte, Xenopus laevis, Rind (Kuh), Zebrafisch (Danio rerio), Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-THO Complex 4 (THOC4) antibodyTHOC4 Reaktivität: Human, Maus, Xenopus laevis WB, ELISA, IF, IP, IHC (p), ICC, ChIP, EM, FACS Wirt: Maus Monoclonal 11G5 unconjugated
anti-THO Complex 4 (THOC4) (N-Term) antibodyTHOC4 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Zebrafisch (Danio rerio), Hund WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
THOC4 Blocking Peptide, catalog no. 33R-3282, is also available for use as a blocking control in assays to test for specificity of this THOC4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- THO Complex 4 (THOC4)
- Andere Bezeichnung
- THOC4 (THOC4 Produkte)
- Synonyme
- THOC4 antikoerper, Aly antikoerper, ALY antikoerper, ALY/REF antikoerper, BEF antikoerper, REF antikoerper, tho4 antikoerper, thoc4 antikoerper, zgc:171753 antikoerper, Tho4-A antikoerper, alyref-a antikoerper, thoc4-a antikoerper, REF1 antikoerper, Refbp1 antikoerper, Thoc4 antikoerper, Tho4 antikoerper, Aly/REF export factor antikoerper, THO complex 4 antikoerper, Aly/REF export factor L homeolog antikoerper, ALYREF antikoerper, Thoc4 antikoerper, alyref antikoerper, alyref.L antikoerper, Alyref antikoerper
- Hintergrund
- THOC4 is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.
- Molekulargewicht
- 28 kDa (MW of target protein)
-
