HNRNPH3 Antikörper
-
- Target Alle HNRNPH3 Antikörper anzeigen
- HNRNPH3 (Heterogeneous Nuclear Ribonucleoprotein H3 (2H9) (HNRNPH3))
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HNRNPH3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- HNRPH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY
- Top Product
- Discover our top product HNRNPH3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HNRPH3 Blocking Peptide, catalog no. 33R-2244, is also available for use as a blocking control in assays to test for specificity of this HNRPH3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPH3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPH3 (Heterogeneous Nuclear Ribonucleoprotein H3 (2H9) (HNRNPH3))
- Andere Bezeichnung
- HNRPH3 (HNRNPH3 Produkte)
- Synonyme
- AA693301 antikoerper, AI666703 antikoerper, Hnrph3 antikoerper, hnrph3 antikoerper, HNRPH3 antikoerper, 2H9 antikoerper, heterogeneous nuclear ribonucleoprotein H3 antikoerper, heterogeneous nuclear ribonucleoprotein H3 L homeolog antikoerper, Hnrnph3 antikoerper, hnrnph3.L antikoerper, HNRNPH3 antikoerper
- Hintergrund
- HNRPH3 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.
- Molekulargewicht
- 38 kDa (MW of target protein)
-