SURF6 Antikörper (Middle Region)

Produktnummer ABIN629898

Dieses Anti-SURF6-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SURF6 in WB und IHC. Geeignet für Human.

Kurzübersicht für SURF6 Antikörper (Middle Region) (ABIN629898)

Target: SURF6 (Surfeit 6 (SURF6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SURF6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SURF6 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SURF6 antibody was raised against the middle region of SURF6

Aufreinigung: Purified

Immunogen: SURF6 antibody was raised using the middle region of SURF6 corresponding to a region with amino acids EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SURF6 Blocking Peptide, (ABIN938030), is also available for use as a blocking control in assays to test for specificity of this SURF6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SURF6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SURF6

Target: SURF6 (Surfeit 6 (SURF6))

Andere Bezeichnung: SURF6

Hintergrund: This gene is located in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. The gene demonstrates features of a housekeeping gene, being ubiquitously expressed, and the encoded protein has been localized to the nucleolus. The protein includes motifs found in both the mouse and fish orthologs, which suggests a putative function as a nucleolar-matrix protein with nucleic acid-binding properties, based on characteristics determined in mouse.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly