HNRPDL Antikörper (Middle Region)

Produktnummer ABIN629895

Dieses Anti-HNRPDL-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von HNRPDL in WB und IHC. Geeignet für Human, Maus und Hund.

Kurzübersicht für HNRPDL Antikörper (Middle Region) (ABIN629895)

Target: HNRPDL (Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRPDL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-HNRPDL Antikörper

Bindungsspezifität: Middle Region

Spezifität: HNRPDL antibody was raised against the middle region of HNRPDL

Aufreinigung: Purified

Immunogen: HNRPDL antibody was raised using the middle region of HNRPDL corresponding to a region with amino acids TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRPDL Blocking Peptide, (ABIN5614046), is also available for use as a blocking control in assays to test for specificity of this HNRPDL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPDL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRPDL

Target: HNRPDL (Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL))

Andere Bezeichnung: HNRPDL

Hintergrund: HNRPDL belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPDL has two RRM domains that bind to RNAs.

Molekulargewicht: 40 kDa (MW of target protein)