HNRNPK Antikörper (C-Term)

Produktnummer ABIN629892

Dieses Anti-HNRNPK-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von HNRNPK in WB und IHC. Geeignet für Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für HNRNPK Antikörper (C-Term) (ABIN629892)

Target: HNRNPK (Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-HNRNPK Antikörper

Bindungsspezifität: C-Term

Spezifität: HNRPK antibody was raised against the C terminal of HNRPK

Aufreinigung: Purified

Immunogen: HNRPK antibody was raised using the C terminal of HNRPK corresponding to a region with amino acids YSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRPK Blocking Peptide, (ABIN936231), is also available for use as a blocking control in assays to test for specificity of this HNRPK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPK

Target: HNRNPK (Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK))

Andere Bezeichnung: HNRPK

Hintergrund: HNRPK belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Molekulargewicht: 51 kDa (MW of target protein)