RBMS3 Antikörper (N-Term)

Produktnummer ABIN629890

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RBMS3 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Hund, Ratte und Zebrafisch (Danio rerio).

Kurzübersicht für RBMS3 Antikörper (N-Term) (ABIN629890)

Target: RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))

Reaktivität: Human, Maus, Hund, Ratte, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBMS3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RBMS3 Antikörper

Bindungsspezifität: N-Term

Spezifität: RBMS3 antibody was raised against the N terminal of RBMS3

Aufreinigung: Purified

Immunogen: RBMS3 antibody was raised using the N terminal of RBMS3 corresponding to a region with amino acids GVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBMS3 Blocking Peptide, (ABIN939037), is also available for use as a blocking control in assays to test for specificity of this RBMS3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBMS3

Target: RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))

Andere Bezeichnung: RBMS3

Hintergrund: RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.

Molekulargewicht: 46 kDa (MW of target protein)