PPP1R8 Antikörper

Produktnummer ABIN629887

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PPP1R8 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für PPP1R8 Antikörper (ABIN629887)

Target: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP1R8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PPP1R8 Antikörper

Aufreinigung: Purified

Immunogen: PPP1 R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP1R8 Blocking Peptide, (ABIN5615513), is also available for use as a blocking control in assays to test for specificity of this PPP1R8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP1R8

Target: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Andere Bezeichnung: PPP1R8

Hintergrund: This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.

Molekulargewicht: 14 kDa (MW of target protein)