PPP1R8 Antikörper

Produktnummer ABIN629887

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PPP1R8 in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte und Hund.

Kurzübersicht für PPP1R8 Antikörper (ABIN629887)

Target: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP1R8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PPP1R8 Antikörper

Aufreinigung: Purified

Immunogen: PPP1 R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP1R8 Blocking Peptide, (ABIN5615513), is also available for use as a blocking control in assays to test for specificity of this PPP1R8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP1R8

Target: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Andere Bezeichnung: PPP1R8

Hintergrund: This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.

Molekulargewicht: 14 kDa (MW of target protein)