HNRNPA1 Antikörper (C-Term)

Produktnummer ABIN629886

Dieses Anti-HNRNPA1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von HNRNPA1 in WB und IHC. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für HNRNPA1 Antikörper (C-Term) (ABIN629886)

Target: HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-HNRNPA1 Antikörper

Bindungsspezifität: C-Term

Spezifität: HNRPA1 antibody was raised against the C terminal of HNRPA1

Aufreinigung: Purified

Immunogen: HNRPA1 antibody was raised using the C terminal of HNRPA1 corresponding to a region with amino acids NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSG

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRPA1 Blocking Peptide, (ABIN5614042), is also available for use as a blocking control in assays to test for specificity of this HNRPA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPA1

Target: HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))

Andere Bezeichnung: HNRPA1

Hintergrund: HNRPA1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). HNRPA1 has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. HNRPA1 is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition.

Molekulargewicht: 35 kDa (MW of target protein)