DDX49 Antikörper

Produktnummer ABIN629881

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DDX49 in WB. Er zeigt eine Reaktivität gegenüber Human, Hund und Maus.

Kurzübersicht für DDX49 Antikörper (ABIN629881)

Target: DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))

Reaktivität: Human, Hund, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX49 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDX49 Antikörper

Aufreinigung: Purified

Immunogen: DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX49 Blocking Peptide, (ABIN937916), is also available for use as a blocking control in assays to test for specificity of this DDX49 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX49 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX49

Target: DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))

Andere Bezeichnung: DDX49

Hintergrund: The function of Anti-DDX49 has not yet been determined.

Molekulargewicht: 53 kDa (MW of target protein)