ERI1 Antikörper (C-Term)

Produktnummer ABIN629880

Dieses Anti-ERI1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ERI1 in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für ERI1 Antikörper (C-Term) (ABIN629880)

Target: ERI1 (Exoribonuclease 1 (ERI1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ERI1 Antikörper

Bindungsspezifität: C-Term

Spezifität: THEX1 antibody was raised against the C terminal of theX1

Aufreinigung: Purified

Immunogen: THEX1 antibody was raised using the C terminal of theX1 corresponding to a region with amino acids GSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIM

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

THEX1 Blocking Peptide, (ABIN938983), is also available for use as a blocking control in assays to test for specificity of this THEX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THEX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERI1

Target: ERI1 (Exoribonuclease 1 (ERI1))

Andere Bezeichnung: THEX1

Hintergrund: THEX1 contains 1 SAP domain and 1 exonuclease domain. It is an RNA exonuclease that binds to the 3' end of histone mRNAs and probably degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. It is also able to degrade the 3' overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi).

Molekulargewicht: 38 kDa (MW of target protein)