MOV10 Antikörper
-
- Target Alle MOV10 Antikörper anzeigen
- MOV10 (Moloney Leukemia Virus 10 (MOV10))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MOV10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- MOV10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR
- Top Product
- Discover our top product MOV10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MOV10 Blocking Peptide, catalog no. 33R-1300, is also available for use as a blocking control in assays to test for specificity of this MOV10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOV10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MOV10 (Moloney Leukemia Virus 10 (MOV10))
- Andere Bezeichnung
- MOV10 (MOV10 Produkte)
- Hintergrund
- MOV10 may be an helicase with an important function in development and/or control of cell proliferation.
- Molekulargewicht
- 110 kDa (MW of target protein)
- Pathways
- Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, SARS-CoV-2 Protein Interaktom
-