TMEM108 Antikörper (Middle Region)

Produktnummer ABIN629878

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch TMEM108 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Hund und Ratte.

Kurzübersicht für TMEM108 Antikörper (Middle Region) (ABIN629878)

Target: TMEM108 (Transmembrane Protein 108 (TMEM108))

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM108 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM108 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TMEM108 antibody was raised against the middle region of TMEM108

Aufreinigung: Purified

Immunogen: TMEM108 antibody was raised using the middle region of TMEM108 corresponding to a region with amino acids NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM108 Blocking Peptide, (ABIN5616655), is also available for use as a blocking control in assays to test for specificity of this TMEM108 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM108 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM108

Target: TMEM108 (Transmembrane Protein 108 (TMEM108))

Andere Bezeichnung: TMEM108

Hintergrund: TMEM108's function has not been determined yet.

Molekulargewicht: 54 kDa (MW of target protein)