CHD1L Antikörper (Middle Region)

Produktnummer ABIN629877

Produktdetails anti-CHD1L Antikörper

Target: CHD1L (Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHD1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHD1 L antibody was raised against the middle region of CHD1

Aufreinigung: Purified

Immunogen: CHD1 L antibody was raised using the middle region of CHD1 corresponding to a region with amino acids DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHD1L Blocking Peptide, catalog no. 33R-1859, is also available for use as a blocking control in assays to test for specificity of this CHD1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHD1L

Target: CHD1L (Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L))

Andere Bezeichnung: CHD1L (CHD1L Produkte)

Synonyme: CHD1L antikoerper, ALC1 antikoerper, CHDL antikoerper, 4432404A22Rik antikoerper, Alc1 antikoerper, Snf2p antikoerper, zgc:56084 antikoerper, chromodomain helicase DNA binding protein 1 like antikoerper, chromodomain helicase DNA binding protein 1-like antikoerper, CHD1L antikoerper, chd1l antikoerper, Chd1l antikoerper

Hintergrund: CHD1L encodes a protein that interacts with ADP-ribose. ADP-ribosylation of proteins is an important post-translational modification that occurs in a variety of biological processes, including DNA repair, transcription, chromatin biology and long-term memory formation.

Molekulargewicht: 45 kDa (MW of target protein)