Retinoic Acid Receptor alpha Antikörper (N-Term)

Produktnummer ABIN629874

Dieser Anti-Retinoic Acid Receptor alpha-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von Retinoic Acid Receptor alpha in WB. Geeignet für Human.

Kurzübersicht für Retinoic Acid Receptor alpha Antikörper (N-Term) (ABIN629874)

Target: Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Retinoic Acid Receptor alpha Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Retinoic Acid Receptor alpha Antikörper

Bindungsspezifität: N-Term

Spezifität: RARA antibody was raised against the N terminal of RARA

Aufreinigung: Purified

Immunogen: RARA antibody was raised using the N terminal of RARA corresponding to a region with amino acids TPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIETQS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RARA Blocking Peptide, (ABIN5615760), is also available for use as a blocking control in assays to test for specificity of this RARA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Retinoic Acid Receptor alpha

Target: Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))

Andere Bezeichnung: RARA

Hintergrund: RARA contains 1 nuclear receptor DNA-binding domain and belongs to the nuclear hormone receptor family, NR1 subfamily. It is a receptor for retinoic acid. This metabolite has profound effects on vertebrate development. Retinoic acid is a morphogen and is a powerful teratogen. This receptor controls cell function by directly regulating gene expression

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, S100 Proteine