GGTLC1 Antikörper (C-Term)

Produktnummer ABIN629871

Dieses Anti-GGTLC1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von GGTLC1 in IHC und WB. Geeignet für Human, Hund, Maus und Ratte.

Kurzübersicht für GGTLC1 Antikörper (C-Term) (ABIN629871)

Target: GGTLC1 (gamma-Glutamyltransferase Light Chain 1 (GGTLC1))

Reaktivität: Human, Hund, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GGTLC1 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Produktdetails anti-GGTLC1 Antikörper

Bindungsspezifität: C-Term

Spezifität: GGTLA4 antibody was raised against the C terminal of GGTLA4

Aufreinigung: Purified

Immunogen: GGTLA4 antibody was raised using the C terminal of GGTLA4 corresponding to a region with amino acids DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GGTLA4 Blocking Peptide, (ABIN937514), is also available for use as a blocking control in assays to test for specificity of this GGTLA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGTLA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GGTLC1

Target: GGTLC1 (gamma-Glutamyltransferase Light Chain 1 (GGTLC1))

Andere Bezeichnung: GGTLA4

Hintergrund: Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein is similar in sequence to several members of the gamma-glutamyl transpeptidase family.Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione.

Molekulargewicht: 25 kDa (MW of target protein)