Niban Antikörper (N-Term)

Produktnummer ABIN629867

Der Kaninchen Polyklonal Anti-Niban-Antikörper wurde für WB validiert. Er ist geeignet, Niban in Proben von Human zu detektieren.

Kurzübersicht für Niban Antikörper (N-Term) (ABIN629867)

Target: Niban (FAM129A) (Family with Sequence Similarity 129, Member A (FAM129A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Niban Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Niban Antikörper

Bindungsspezifität: N-Term

Spezifität: FAM129 A antibody was raised against the N terminal of FAM129

Aufreinigung: Purified

Immunogen: FAM129 A antibody was raised using the N terminal of FAM129 corresponding to a region with amino acids SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM129A Blocking Peptide, (ABIN5613468), is also available for use as a blocking control in assays to test for specificity of this FAM129A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM120 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Niban

Target: Niban (FAM129A) (Family with Sequence Similarity 129, Member A (FAM129A))

Andere Bezeichnung: FAM129A

Hintergrund: FAM129A is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis and it is a novel tumor marker.

Molekulargewicht: 103 kDa (MW of target protein)