HSPB6 Antikörper (Middle Region)
-
- Target Alle HSPB6 Antikörper anzeigen
- HSPB6 (Heat Shock Protein, alpha-Crystallin-Related, B6 (HSPB6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HSPB6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HSPB6 antibody was raised against the middle region of HSPB6
- Aufreinigung
- Purified
- Immunogen
- HSPB6 antibody was raised using the middle region of HSPB6 corresponding to a region with amino acids ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS
- Top Product
- Discover our top product HSPB6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HSPB6 Blocking Peptide, catalog no. 33R-1474, is also available for use as a blocking control in assays to test for specificity of this HSPB6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPB6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSPB6 (Heat Shock Protein, alpha-Crystallin-Related, B6 (HSPB6))
- Andere Bezeichnung
- HSPB6 (HSPB6 Produkte)
- Synonyme
- Hsp20 antikoerper, p20 antikoerper, AA387366 antikoerper, Gm479 antikoerper, HSP20 antikoerper, heat shock protein family B (small) member 6 antikoerper, heat shock protein, alpha-crystallin-related, B6 antikoerper, heat shock protein family B (small) member 6 L homeolog antikoerper, heat shock protein, alpha-crystallin-related, b6 antikoerper, HSPB6 antikoerper, Hspb6 antikoerper, hspb6.L antikoerper, hspb6 antikoerper
- Hintergrund
- HSPB6 is associated with actin and modulates smooth muscle relaxation.HSPB6 is associated with actin and modulates smooth muscle relaxation.
- Molekulargewicht
- 17 kDa (MW of target protein)
-