LZTFL1 Antikörper (C-Term)
-
- Target Alle LZTFL1 Antikörper anzeigen
- LZTFL1 (Leucine Zipper Transcription Factor-Like 1 (LZTFL1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LZTFL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LZTFL1 antibody was raised against the C terminal of LZTFL1
- Aufreinigung
- Purified
- Immunogen
- LZTFL1 antibody was raised using the C terminal of LZTFL1 corresponding to a region with amino acids VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
- Top Product
- Discover our top product LZTFL1 Primärantikörper
-
anti-Leucine Zipper Transcription Factor-Like 1 (LZTFL1) (AA 200-299) antibody
LZTFL1 Reaktivität: Human WB, ELISA, IF, IHC (p) Wirt: Maus Monoclonal 7F6 unconjugated
anti-Leucine Zipper Transcription Factor-Like 1 (LZTFL1) (AA 116-299) antibodyLZTFL1 Reaktivität: Human WB, ELISA, IHC, IP, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Leucine Zipper Transcription Factor-Like 1 (LZTFL1) (AA 101-200) antibodyLZTFL1 Reaktivität: Maus, Ratte WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Leucine Zipper Transcription Factor-Like 1 (LZTFL1) (AA 39-120) antibodyLZTFL1 Reaktivität: Human WB, ELISA, IP Wirt: Maus Monoclonal 1B1 unconjugated
anti-Leucine Zipper Transcription Factor-Like 1 (LZTFL1) antibodyLZTFL1 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Leucine Zipper Transcription Factor-Like 1 (LZTFL1) (AA 200-299) antibodyLZTFL1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Leucine Zipper Transcription Factor-Like 1 (LZTFL1) (AA 1-299) antibodyLZTFL1 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Leucine Zipper Transcription Factor-Like 1 (LZTFL1) antibodyLZTFL1 Reaktivität: Human WB, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Leucine Zipper Transcription Factor-Like 1 (LZTFL1) (AA 4-30), (N-Term) antibodyLZTFL1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB38294 unconjugated
anti-Leucine Zipper Transcription Factor-Like 1 (LZTFL1) (C-Term) antibodyLZTFL1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Schwein, Fledermaus, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LZTFL1 Blocking Peptide, catalog no. 33R-9745, is also available for use as a blocking control in assays to test for specificity of this LZTFL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LZTFL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LZTFL1 (Leucine Zipper Transcription Factor-Like 1 (LZTFL1))
- Andere Bezeichnung
- LZTFL1 (LZTFL1 Produkte)
- Synonyme
- lztfl1 antikoerper, MGC53120 antikoerper, LZTFL1 antikoerper, DKFZp469B0113 antikoerper, fb53f12 antikoerper, wu:fb53f12 antikoerper, zgc:56268 antikoerper, BBS17 antikoerper, 5530402H04Rik antikoerper, 6130400H19Rik antikoerper, AI414725 antikoerper, AW048545 antikoerper, leucine zipper transcription factor like 1 L homeolog antikoerper, leucine zipper transcription factor like 1 antikoerper, leucine zipper transcription factor-like 1 antikoerper, lztfl1.L antikoerper, LZTFL1 antikoerper, lztfl1 antikoerper, Lztfl1 antikoerper
- Hintergrund
- LZTFL1 may be involved in vesicle-mediated transport.
- Molekulargewicht
- 34 kDa (MW of target protein)
-
