LZTFL1 Antikörper (C-Term)
Kurzübersicht für LZTFL1 Antikörper (C-Term) (ABIN629864)
Target
Alle LZTFL1 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- C-Term
-
Spezifität
- LZTFL1 antibody was raised against the C terminal of LZTFL1
-
Aufreinigung
- Purified
-
Immunogen
- LZTFL1 antibody was raised using the C terminal of LZTFL1 corresponding to a region with amino acids VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
-
-
-
-
Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
LZTFL1 Blocking Peptide, (ABIN5614620), is also available for use as a blocking control in assays to test for specificity of this LZTFL1 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LZTFL1 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- LZTFL1 (Leucine Zipper Transcription Factor-Like 1 (LZTFL1))
-
Andere Bezeichnung
- LZTFL1
-
Hintergrund
- LZTFL1 may be involved in vesicle-mediated transport.
-
Molekulargewicht
- 34 kDa (MW of target protein)
Target
-