LZTFL1 Antikörper (C-Term)

Produktnummer ABIN629864

Der Kaninchen Polyklonal anti-LZTFL1 Antikörper wird verwendet zum Nachweis von LZTFL1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für LZTFL1 Antikörper (C-Term) (ABIN629864)

Target: LZTFL1 (Leucine Zipper Transcription Factor-Like 1 (LZTFL1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LZTFL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LZTFL1 Antikörper

Bindungsspezifität: C-Term

Spezifität: LZTFL1 antibody was raised against the C terminal of LZTFL1

Aufreinigung: Purified

Immunogen: LZTFL1 antibody was raised using the C terminal of LZTFL1 corresponding to a region with amino acids VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LZTFL1 Blocking Peptide, (ABIN5614620), is also available for use as a blocking control in assays to test for specificity of this LZTFL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LZTFL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LZTFL1

Target: LZTFL1 (Leucine Zipper Transcription Factor-Like 1 (LZTFL1))

Andere Bezeichnung: LZTFL1

Hintergrund: LZTFL1 may be involved in vesicle-mediated transport.

Molekulargewicht: 34 kDa (MW of target protein)