IFI44L Antikörper (N-Term)

Produktnummer ABIN629863

Produktdetails anti-IFI44L Antikörper

Target: IFI44L (Interferon-Induced Protein 44-Like (IFI44L))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFI44L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: IFI44 L antibody was raised against the N terminal of IFI44

Aufreinigung: Purified

Immunogen: IFI44 L antibody was raised using the N terminal of IFI44 corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFI44L Blocking Peptide, catalog no. 33R-5983, is also available for use as a blocking control in assays to test for specificity of this IFI44L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFI40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IFI44L

Target: IFI44L (Interferon-Induced Protein 44-Like (IFI44L))

Andere Bezeichnung: IFI44L (IFI44L Produkte)

Synonyme: C1orf29 antikoerper, H-28 antikoerper, H28 antikoerper, H28-1 antikoerper, NS1178 antikoerper, IFI44L antikoerper, interferon induced protein 44 like antikoerper, interferon-induced protein 44 like antikoerper, interferon-induced protein 44-like antikoerper, IFI44L antikoerper, Ifi44l antikoerper, LOC100465846 antikoerper, LOC100538089 antikoerper, ifi44l antikoerper

Hintergrund: The function of this gene remains unknown.

Molekulargewicht: 47 kDa (MW of target protein)