STIP1 Antikörper

Produktnummer ABIN629861

Der Kaninchen Polyklonal Anti-STIP1-Antikörper wurde für WB validiert. Er ist geeignet, STIP1 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für STIP1 Antikörper (ABIN629861)

Target: STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STIP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-STIP1 Antikörper

Aufreinigung: Purified

Immunogen: STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STIP1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this STIP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STIP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STIP1

Target: STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))

Andere Bezeichnung: STIP1

Hintergrund: STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).

Molekulargewicht: 63 kDa (MW of target protein)