SHMT2 Antikörper

Produktnummer ABIN629860

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SHMT2 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für SHMT2 Antikörper (ABIN629860)

Target: SHMT2 (serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SHMT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SHMT2 Antikörper

Aufreinigung: Purified

Immunogen: SHMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SHMT2 Blocking Peptide, (ABIN937936), is also available for use as a blocking control in assays to test for specificity of this SHMT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHMT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SHMT2

Target: SHMT2 (serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2))

Andere Bezeichnung: SHMT2

Hintergrund: SHMT2 plays a role in interconversion of serine and glycine.

Molekulargewicht: 56 kDa (MW of target protein)