PARP11 Antikörper

Produktnummer ABIN629858

Produktdetails anti-PARP11 Antikörper

Target: PARP11 (Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PARP11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PARP11 Blocking Peptide, catalog no. 33R-8294, is also available for use as a blocking control in assays to test for specificity of this PARP11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PARP11

Target: PARP11 (Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11))

Andere Bezeichnung: PARP11 (PARP11 Produkte)

Hintergrund: Poly(ADP-ribosyl)ation is a DNA-damage-dependent post-translational modification of histones. Poly(ADP-ribose) polymerases (PARPs) are a family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain.

Molekulargewicht: 39 kDa (MW of target protein)