MORF4L1 Antikörper (Middle Region)

Produktnummer ABIN629857

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MORF4L1 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für MORF4L1 Antikörper (Middle Region) (ABIN629857)

Target: MORF4L1 (Mortality Factor 4 Like 1 (MORF4L1))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MORF4L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-MORF4L1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MORF4 L1 antibody was raised against the middle region of MORF4 1

Aufreinigung: Purified

Immunogen: MORF4 L1 antibody was raised using the middle region of MORF4 1 corresponding to a region with amino acids YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ

Anwendungsinformationen

Applikationshinweise: WB: 5-10 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MORF4L1 Blocking Peptide, (ABIN936012), is also available for use as a blocking control in assays to test for specificity of this MORF4L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MORF0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MORF4L1

Target: MORF4L1 (Mortality Factor 4 Like 1 (MORF4L1))

Andere Bezeichnung: MORF4L1

Hintergrund: MORF4L1 is a novel chromodomain protein that is present in two distinct multiprotein complexes involved in transcriptional activation.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Chromatin Binding