CUEDC1 Antikörper (Middle Region)
-
- Target Alle CUEDC1 Antikörper anzeigen
- CUEDC1 (CUE Domain Containing 1 (CUEDC1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CUEDC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CUEDC1 antibody was raised against the middle region of CUEDC1
- Aufreinigung
- Purified
- Immunogen
- CUEDC1 antibody was raised using the middle region of CUEDC1 corresponding to a region with amino acids RNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE
- Top Product
- Discover our top product CUEDC1 Primärantikörper
-
anti-CUE Domain Containing 1 (CUEDC1) (AA 1-386) antibody
CUEDC1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 4F9 unconjugated
anti-CUE Domain Containing 1 (CUEDC1) (AA 251-300) antibodyCUEDC1 Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-CUE Domain Containing 1 (CUEDC1) (C-Term) antibodyCUEDC1 Reaktivität: Human, Maus, Ratte WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CUEDC1 Blocking Peptide, catalog no. 33R-8082, is also available for use as a blocking control in assays to test for specificity of this CUEDC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUEDC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CUEDC1 (CUE Domain Containing 1 (CUEDC1))
- Andere Bezeichnung
- CUEDC1 (CUEDC1 Produkte)
- Synonyme
- AI841487 antikoerper, C330016O16Rik antikoerper, RGD1304861 antikoerper, CUEDC1 antikoerper, zgc:153423 antikoerper, zgc:162271 antikoerper, CUE domain containing 1 antikoerper, CUE domain containing 1 L homeolog antikoerper, CUE domain containing 1a antikoerper, CUE domain containing 1b antikoerper, CUEDC1 antikoerper, Cuedc1 antikoerper, cuedc1.L antikoerper, cuedc1 antikoerper, cuedc1a antikoerper, cuedc1b antikoerper
- Hintergrund
- The function of CUE protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 42 kDa (MW of target protein)
-
