CUEDC1 Antikörper (Middle Region)

Produktnummer ABIN629850

Der Kaninchen Polyklonal anti-CUEDC1 Antikörper (ABIN629850) detektiert spezifisch CUEDC1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus, Ratte und Hund.

Kurzübersicht für CUEDC1 Antikörper (Middle Region) (ABIN629850)

Target: CUEDC1 (CUE Domain Containing 1 (CUEDC1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CUEDC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CUEDC1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CUEDC1 antibody was raised against the middle region of CUEDC1

Aufreinigung: Purified

Immunogen: CUEDC1 antibody was raised using the middle region of CUEDC1 corresponding to a region with amino acids RNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CUEDC1 Blocking Peptide, (ABIN5613031), is also available for use as a blocking control in assays to test for specificity of this CUEDC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUEDC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CUEDC1

Target: CUEDC1 (CUE Domain Containing 1 (CUEDC1))

Andere Bezeichnung: CUEDC1

Hintergrund: The function of CUE protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 42 kDa (MW of target protein)